PDB entry 2rft

View 2rft on RCSB PDB site
Description: Crystal structure of influenza B virus hemagglutinin in complex with LSTa receptor analog
Class: viral protein
Keywords: Influenza, viral protein, receptor specificity, Envelope protein, Fusion protein, Hemagglutinin, Membrane, Transmembrane, Virion, Glycoprotein, Lipoprotein, Palmitate
Deposited on 2007-10-01, released 2008-02-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.282
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Influenza B hemagglutinin (HA)
    Species: Influenza B virus (STRAIN B/HONG KONG/8/73) [TaxId:11531]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rfta_
  • Chain 'B':
    Compound: Influenza B hemagglutinin (HA)
    Species: Influenza B virus (STRAIN B/HONG KONG/8/73) [TaxId:11531]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rftb1
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rftA (A:)
    drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtqtrgklcpnclnc
    tdldvalgrpkcmgtipsakasilhevkpvtsgcfpimhdrtkirqlpnllrgyenirls
    arnvtnaetapggpyivgtsgscpnvtngngffatmawavpknktatnpltvevpyictk
    gedqitvwgfhsddetqmvklygdskpqkftssangvtthyvsqiggfpnqaedeglpqs
    grivvdymvqkpgktgtiayqrgvllpqkvwcasgrskvikgslpligeadclhekyggl
    nkskpyytgehakaigncpiwvktplklangtkyrppakllker
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rftA (A:)
    drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtqtrgklcpnclnc
    tdldvalgrpkcmgtipsakasilhevkpvtsgcfpimhdrtkirqlpnllrgyenirls
    arnvtnaetapggpyivgtsgscpnvtngngffatmawavpknktatnpltvevpyictk
    gedqitvwgfhsddetqmvklygdskpqkftssangvtthyvsqiggfpnqaedeglpqs
    grivvdymvqkpgktgtiayqrgvllpqkvwcasgrskvikgslpligeadclhekyggl
    nkskpyytgehakaigncpiwvktplklangtkyrppakllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rftB (B:)
    gffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselev
    knlqrlsgamdelhneileldekvddlradtissqielavllsnegiinsedehllaler
    klkkmlgpsavdigngcfetkhkcnqtcldriaagtfnagefslptfdslnitaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rftB (B:)
    gffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselev
    knlqrlsgamdelhneileldekvddlradtissqielavllsnegiinsedehllaler
    klkkmlgpsavdigngcfetkhkcnqtcldriaagtfnagefslptfds