PDB entry 2rfs

View 2rfs on RCSB PDB site
Description: X-ray structure of SU11274 bound to c-Met
Class: transferase
Keywords: c-Met, receptor tyrosine kinase, SU11274, ATP-binding, Glycoprotein, Membrane, Nucleotide-binding, Phosphorylation, Proto-oncogene, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2007-10-01, released 2007-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581
      • conflict (225)
    Domains in SCOPe 2.06: d2rfsa_
  • Heterogens: AM8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rfsA (A:)
    mqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfsA (A:)
    qhvvigpsslivhfnevigrghfgcvyhgtlkihcavkslnigevsqfltegiimkdfsh
    pnvlsllgiclsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkf
    vhrdlaarncmldekftvkvadfglardmydkeyysvhtgaklpvkwmaleslqtqkftt
    ksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhp
    kaemrpsfselvsrisaifstfig