PDB entry 2rfr

View 2rfr on RCSB PDB site
Description: Crystal structure of an ntf2-like protein with a cystatin-like fold (saro_3722) from novosphingobium aromaticivorans dsm at 1.16 A resolution
Class: unknown function
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2007-10-01, released 2007-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: YP_001166107.1, Saro_3722
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4XF70 (1-End)
      • leader sequence (0)
    Domains in SCOPe 2.08: d2rfra1, d2rfra2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2rfrA (A:)
gmddltnlaarlrlledreeireliarygpladsgdaealselwvedgeyavvgfatakg
raaiaalidgqthralmadgcahflgpatvtvegdtatarchsvvfrcvsgtfgshrvsa
nrwtfrrtpagwravrrenalldgsaaarallqfr

    Sequence, based on observed residues (ATOM records): (download) 
    >2rfrA (A:)
gmddltnlaarlrlledreeireliarygpladsgdaealselwvedgeyavvgfatakg
raaiaalidgqthralmadgcahflgpatvtvegdtatarchsvvfrcvsgtfgshrvsa
nrwtfrrtpagwravrrenalldgsaaarallqf