PDB entry 2rfp

View 2rfp on RCSB PDB site
Description: Crystal structure of Putative NTP Pyrophosphohydrolase (YP_001813558.1) from Exiguobacterium sibiricum 255-15 at 1.74 A resolution
Deposited on 2007-10-01, released 2007-10-16
The last revision was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.184
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative NTP pyrophosphohydrolase
    Species: Exiguobacterium sibiricum [TaxId:262543]
    Gene: YP_189071.1, ExigDRAFT_0305
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2rfpA (A:)
gmkqpnyyqdvkqfhqtfhhpgadqptaipldrgvkratwtaeeavveflhqssqnetef
laaietfkagldqavkkslketypvteverlvgqgdaltdalyfimgsfveaglepgplf
eivqqanmaklgpdgqpifresdqkvmkpdgwlppepqleaevvrqmkeka

    Sequence, based on observed residues (ATOM records):
    >2rfpA (A:)
kqpnyyqdvkqfhqtfhhpgadqptaipldrgvkratwtaeeavveflhqssqnetefla
aietfkagldqavkkslketypvteverlvgqgdaltdalyfimgsfveaglepgplfei
vqqanmaklgpdgqpifresdqkvmkpdgwlppepqleaevvrqmkeka