PDB entry 2rfn

View 2rfn on RCSB PDB site
Description: x-ray structure of c-Met with inhibitor.
Class: transferase
Keywords: c-Met HGF receptor tyrosine kinse kinase domain, ATP-binding, Glycoprotein, Membrane, Nucleotide-binding, Phosphorylation, Proto-oncogene, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2007-10-01, released 2007-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-304)
      • conflict (225)
    Domains in SCOPe 2.06: d2rfna_
  • Chain 'B':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-304)
      • conflict (225)
    Domains in SCOPe 2.06: d2rfnb_
  • Heterogens: AM7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rfnA (A:)
    mqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfnA (A:)
    alnpelvqavqhvvigpsslivhfnevifgcvyhgtlldndgkkihcavkslnritdige
    vsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvkd
    ligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadpvkwmaleslqtqkfttk
    sdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpk
    aemrpsfselvsrisaifstfigehyvh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rfnB (B:)
    mqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfnB (B:)
    salnpelvqavqhvvigpsslivhfnevifgcvyhgtlldndgkkihcavkslnritdig
    evsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvk
    dligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadpvkwmaleslqtqkftt
    ksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhp
    kaemrpsfselvsrisaifstfigehyvh