PDB entry 2rfk

View 2rfk on RCSB PDB site
Description: Substrate RNA Positioning in the Archaeal H/ACA Ribonucleoprotein Complex
Class: Isomerase/RNA
Keywords: PROTEIN-RNA COMPLEX, Archaeal H/ACA Ribonucleoprotein Complex, Isomerase, tRNA processing, Ribosome biogenesis, rRNA processing, Isomerase/RNA COMPLEX, Structural Genomics, Southeast Collaboratory for Structural Genomics, SECSG
Deposited on 2007-09-30, released 2008-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.25
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable tRNA pseudouridine synthase B
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7LWY0 (0-333)
      • engineered (77)
    Domains in SCOPe 2.07: d2rfka1, d2rfka2
  • Chain 'B':
    Compound: Ribosome biogenesis protein Nop10
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rfkb_
  • Chain 'C':
    Compound: Small nucleolar rnp similar to gar1
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rfkc_
  • Chain 'D':
    Compound: guide RNA 1
  • Chain 'E':
    Compound: guide RNA 2
  • Chain 'F':
    Compound: target RNA
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rfkA (A:)
    evrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevva
    wikkilnlekaghggtlapkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedk
    iiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirsli
    hhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpme
    kavehlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkamm
    tsqemlektkgiavdvekvfmprdwypklwekrd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rfkB (B:)
    frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rfkC (C:)
    mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
    npeiyvgevlyvde
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.