PDB entry 2rfh

View 2rfh on RCSB PDB site
Description: Crystal Structure Analysis of CPA-2-benzyl-3-nitropropanoic acid complex
Class: hydrolase
Keywords: protein-inhibitor complex, Carboxypeptidase, HYDROLASE
Deposited on 2007-09-29, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase A1
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rfha_
  • Heterogens: ZN, 23N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rfhA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn