PDB entry 2rfg

View 2rfg on RCSB PDB site
Description: Crystal structure of dihydrodipicolinate synthase from Hahella chejuensis at 1.5A resolution
Class: Lyase
Keywords: BETA BARREL, Amino-acid biosynthesis, Diaminopimelate biosynthesis, Lyase, Lysine biosynthesis, Schiff base
Deposited on 2007-09-29, released 2007-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: Hahella chejuensis [TaxId:158327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rfga_
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: Hahella chejuensis [TaxId:158327]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2S9K4 (0-288)
      • expression tag (289-296)
    Domains in SCOPe 2.07: d2rfgb1, d2rfgb2
  • Chain 'C':
    Compound: Dihydrodipicolinate synthase
    Species: Hahella chejuensis [TaxId:158327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rfgc_
  • Chain 'D':
    Compound: Dihydrodipicolinate synthase
    Species: Hahella chejuensis [TaxId:158327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rfgd_
  • Heterogens: MG, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rfgA (A:)
    mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva
    lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm
    vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf
    sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe
    alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfgA (A:)
    mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva
    lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm
    vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf
    sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe
    alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rfgB (B:)
    mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva
    lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm
    vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf
    sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe
    alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyrlehhhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rfgC (C:)
    mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva
    lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm
    vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf
    sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe
    alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfgC (C:)
    mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva
    lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm
    vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf
    sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe
    alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rfgD (D:)
    mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva
    lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm
    vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf
    sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe
    alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfgD (D:)
    mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva
    lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm
    vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf
    sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe
    alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyr