PDB entry 2rff

View 2rff on RCSB PDB site
Description: crystal structure of a putative nucleotidyltransferase (np_343093.1) from sulfolobus solfataricus at 1.40 a resolution
Deposited on 2007-09-28, released 2007-10-16
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative nucleotidyltransferase
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: NP_343093.1, SSO1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97XP0 (1-110)
      • leader sequence (0)
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rffA (A:)
gmgkgksaiesqirmlklakeiveevassfpnleevyifgsrargdyldtsdidilfvfk
gikemnvfdrmymvsrfirgnvdyivldegekdrvkdkvlfwkrekgfvll