PDB entry 2rfe

View 2rfe on RCSB PDB site
Description: Crystal structure of the complex between the EGFR kinase domain and a Mig6 peptide
Class: transferase
Keywords: kinase domain, inhibition, dimer, Alternative splicing, Anti-oncogene, ATP-binding, Cell cycle, Disease mutation, Glycoprotein, Membrane, Nucleotide-binding, Phosphorylation, Polymorphism, Receptor, Secreted, Transferase, Transmembrane, Tyrosine-protein kinase, Ubl conjugation, Cytoplasm
Deposited on 2007-09-28, released 2007-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (3-End)
      • expression tag (2)
      • engineered (124)
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered (124)
  • Chain 'C':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (3-End)
      • engineered (124)
  • Chain 'D':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered (124)
    Domains in SCOPe 2.07: d2rfed_
  • Chain 'E':
    Compound: ERBB receptor feedback inhibitor 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ERBB receptor feedback inhibitor 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rfeD (D:)
    gamallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkanke
    ildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwc
    vqiaegmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpi
    kwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppi
    ctidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfy
    ralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfeD (D:)
    llrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrspkankeildeayv
    masvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiaegm
    nyledrrlvhrdlaarnvlvktpqhvkitdfglakllgkvpikwmalesilhriythqsd
    vwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidad
    srpkfreliiefskmardpqrylviqgddvvdadeyli
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.