PDB entry 2rfc

View 2rfc on RCSB PDB site
Description: Ligand bound (4-phenylimidazole) Crystal Structure of a Cytochrome P450 from the Thermoacidophilic Archaeon Picrophilus Torridus
Class: oxidoreductase
Keywords: CYTOCHROME P450 THERMOPHILE, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on 2007-09-28, released 2008-01-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.229
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2rfca_
  • Chain 'B':
    Compound: cytochrome p450
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2rfcb_
  • Chain 'C':
    Compound: cytochrome p450
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2rfcc_
  • Chain 'D':
    Compound: cytochrome p450
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2rfcd_
  • Heterogens: HEM, PIM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rfcA (A:)
    mrlndpvhydgawhvykysdvkhvlmndkifssnpgnrysnaggisfitmdnpehkefrd
    isapyflpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmpl
    fklwsdyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekik
    yimlliiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfa
    aedsyinnkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgapl
    arleasialndilnhfkrikidykksrlldnkmvlgydklfls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfcA (A:)
    lndpvhydgawhvykysdvkhvlmndkifssnpgnrysgisfitmdnpehkefrdisapy
    flpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmplfklws
    dyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekikyimll
    iiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfaaedsy
    innkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgaplarlea
    sialndilnhfkrikidykksrlldnkmvlgydklfls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rfcB (B:)
    mrlndpvhydgawhvykysdvkhvlmndkifssnpgnrysnaggisfitmdnpehkefrd
    isapyflpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmpl
    fklwsdyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekik
    yimlliiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfa
    aedsyinnkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgapl
    arleasialndilnhfkrikidykksrlldnkmvlgydklfls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfcB (B:)
    lndpvhydgawhvykysdvkhvlmndkifssnpgnrysgisfitmdnpehkefrdisapy
    flpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmplfklws
    dyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekikyimll
    iiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfaaedsy
    innkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgaplarlea
    sialndilnhfkrikidykksrlldnkmvlgydklfls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rfcC (C:)
    mrlndpvhydgawhvykysdvkhvlmndkifssnpgnrysnaggisfitmdnpehkefrd
    isapyflpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmpl
    fklwsdyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekik
    yimlliiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfa
    aedsyinnkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgapl
    arleasialndilnhfkrikidykksrlldnkmvlgydklfls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfcC (C:)
    lndpvhydgawhvykysdvkhvlmndkifssnpgnrysgisfitmdnpehkefrdisapy
    flpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmplfklws
    dyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekikyimll
    iiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfaaedsy
    innkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgaplarlea
    sialndilnhfkrikidykksrlldnkmvlgydklfls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rfcD (D:)
    mrlndpvhydgawhvykysdvkhvlmndkifssnpgnrysnaggisfitmdnpehkefrd
    isapyflpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmpl
    fklwsdyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekik
    yimlliiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfa
    aedsyinnkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgapl
    arleasialndilnhfkrikidykksrlldnkmvlgydklfls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfcD (D:)
    lndpvhydgawhvykysdvkhvlmndkifssnpgnrysgisfitmdnpehkefrdisapy
    flpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmplfklws
    dyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekikyimll
    iiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfaaedsy
    innkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgaplarlea
    sialndilnhfkrikidykksrlldnkmvlgydklfls