PDB entry 2rfb

View 2rfb on RCSB PDB site
Description: Crystal Structure of a Cytochrome P450 from the Thermoacidophilic Archaeon Picrophilus Torridus
Class: oxidoreductase
Keywords: CYTOCHROME P450 THERMOPHILE, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on 2007-09-28, released 2008-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rfba_
  • Chain 'B':
    Compound: cytochrome p450
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rfbb_
  • Chain 'C':
    Compound: cytochrome p450
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rfbc_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rfbA (A:)
    mrlndpvhydgawhvykysdvkhvlmndkifssnpgnrysnaggisfitmdnpehkefrd
    isapyflpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmpl
    fklwsdyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekik
    yimlliiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfa
    aedsyinnkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgapl
    arleasialndilnhfkrikidykksrlldnkmvlgydklfls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfbA (A:)
    lndpvhydgawhvykysdvkhvlmndkifssnpgnrysgisfitmdnpehkefrdisapy
    flpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmplfklws
    dyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekikyimll
    iiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfaaedsy
    innkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgaplarlea
    sialndilnhfkrikidykksrlldnkmvlgydklfls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rfbB (B:)
    mrlndpvhydgawhvykysdvkhvlmndkifssnpgnrysnaggisfitmdnpehkefrd
    isapyflpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmpl
    fklwsdyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekik
    yimlliiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfa
    aedsyinnkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgapl
    arleasialndilnhfkrikidykksrlldnkmvlgydklfls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfbB (B:)
    mrlndpvhydgawhvykysdvkhvlmndkifssnggisfitmdnpehkefrdisapyflp
    skindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmplfklwsdyi
    ignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekikyimlliig
    gnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfaaedsyinn
    kkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgaplarleasia
    lndilnhfkrikidykksrlldnkmvlgydklfls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rfbC (C:)
    mrlndpvhydgawhvykysdvkhvlmndkifssnpgnrysnaggisfitmdnpehkefrd
    isapyflpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmpl
    fklwsdyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekik
    yimlliiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfa
    aedsyinnkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgapl
    arleasialndilnhfkrikidykksrlldnkmvlgydklfls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rfbC (C:)
    lndpvhydgawhvykysdvkhvlmndkifssnggisfitmdnpehkefrdisapyflpsk
    indykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmplfklwsdyiig
    nkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekikyimlliiggn
    etttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfaaedsyinnkk
    ikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgaplarleasialn
    dilnhfkrikidykksrlldnkmvlgydklfls