PDB entry 2rf6

View 2rf6 on RCSB PDB site
Description: crystal structure of the vaccinia virus dual-specificity phosphatase vh1
Deposited on 2007-09-28, released 2008-09-30
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity protein phosphatase
    Species: Vaccinia virus [TaxId:10245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07239 (5-175)
      • expression tag (0-4)
      • engineered mutation (114)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2rf6A (A:)
    gpeirmdkkslykylllrstgdmhkaksptimtrvtnnvylgnyknamdapssevkfkyv
    lnltmdkytlpnsniniihiplvddtttdiskyfddvtaflskcdqrnepvlvhsaagvn
    rsgamilaylmsknkeslpmlyflyvyhsmrdlrgafvenpsfkrqiiekyvidkn
    

    Sequence, based on observed residues (ATOM records):
    >2rf6A (A:)
    irmdkkslykylllrstgdmhkaksptimtrvtnnvylgnyknamdapssevkfkyvlnl
    tmdkytlpnsniniihiplvddtttdiskyfddvtaflskcdqrnepvlvhsaagvnrsg
    amilaylmsknkeslpmlyflyvyhsmrdlrgafvenpsfkrqiiekyvi