PDB entry 2rf0

View 2rf0 on RCSB PDB site
Description: Crystal structure of human mixed lineage kinase MAP3K10 SH3 domain
Class: transferase
Keywords: MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, Structural Genomics, Structural Genomics Consortium, SGC, ATP-binding, Nucleotide-binding, Phosphorylation, Serine/threonine-protein kinase, Transferase
Deposited on 2007-09-27, released 2007-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase kinase kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K10, MLK2, MST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rf0a_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase kinase kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K10, MLK2, MST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rf0b_
  • Chain 'C':
    Compound: Mitogen-activated protein kinase kinase kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K10, MLK2, MST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rf0c_
  • Chain 'D':
    Compound: Mitogen-activated protein kinase kinase kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K10, MLK2, MST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rf0d_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rf0A (A:)
    mhhhhhhssgvdlgtenlyfqsmgttpagpvwtavfdyeaagdeeltlrrgdrvqvlsqd
    cavsgdegwwtgqlpsgrvgvfpsnyvap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rf0A (A:)
    agpvwtavfdyeaagdeeltlrrgdrvqvlsqdcavsgdegwwtgqlpsgrvgvfpsnyv
    ap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rf0B (B:)
    mhhhhhhssgvdlgtenlyfqsmgttpagpvwtavfdyeaagdeeltlrrgdrvqvlsqd
    cavsgdegwwtgqlpsgrvgvfpsnyvap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rf0B (B:)
    agpvwtavfdyeaagdeeltlrrgdrvqvlsqdegwwtgqlpsgrvgvfpsnyvap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rf0C (C:)
    mhhhhhhssgvdlgtenlyfqsmgttpagpvwtavfdyeaagdeeltlrrgdrvqvlsqd
    cavsgdegwwtgqlpsgrvgvfpsnyvap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rf0C (C:)
    agpvwtavfdyeaagdeeltlrrgdrvqvlsqdcavsgdegwwtgqlpsgrvgvfpsnyv
    ap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rf0D (D:)
    mhhhhhhssgvdlgtenlyfqsmgttpagpvwtavfdyeaagdeeltlrrgdrvqvlsqd
    cavsgdegwwtgqlpsgrvgvfpsnyvap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rf0D (D:)
    gpvwtavfdyeaagdeeltlrrgdrvqvlsqdcavsgdegwwtgqlpsgrvgvfpsnyva
    p