PDB entry 2ren

View 2ren on RCSB PDB site
Description: structure of recombinant human renin, a target for cardiovascular-active drugs, at 2.5 angstroms resolution
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1992-02-05, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: renin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2rena_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2renA (A:)
    ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
    hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
    laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlgg
    sdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssie
    klmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlai
    hamdippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2renA (A:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcstacvyhklfda
    sdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaefdg
    vvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdslggqivlggsdpqhyegnfh
    yinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealgakkr
    lfdyvvkcnegptlpdisfhlggkeytltsadyvfctlaihamdippptgptwalgatfi
    rkfytefdrrnnrigfalar