PDB entry 2rei

View 2rei on RCSB PDB site
Description: Kinase domain of human ephrin type-A receptor 7 (Epha7)
Class: transferase
Keywords: ATP-BINDING, KINASE, NUCLEOTIDE-BINDING, RECEPTOR, SIGNAL, TRANSFERASE, PHOSPHORYLATION, TRANSMEMBRANE, TYROSINE-PROTEIN KINASE, ALTERNATIVE SPLICING, GLYCOPROTEIN, STRUCTURAL GENOMICS CONSORTIUM, SGC, Polymorphism
Deposited on 2007-09-26, released 2007-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.164
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 7
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7, EHK3, HEK11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15375 (Start-310)
      • expression tag (311-313)
    Domains in SCOPe 2.06: d2reia1, d2reia2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2reiA (A:)
    mqegdeelyfhfkfpgtktyidpetyedpnravhqfakeldascikiervigagefgevc
    sgrlklpgkrdvavaiktlkvgytekqrrdflceasimgqfdhpnvvhlegvvtrgkpvm
    iviefmengaldaflrkhdgqftviqlvgmlrgiaagmryladmgyvhrdlaarnilvns
    nlvckvsdfglsrvieddpeavytttggkipvrwtapeaiqyrkftsasdvwsygivmwe
    vmsygerpywdmsnqdvikaieegyrlpapmdcpaglhqlmldcwqkeraerpkfeqivg
    ildkmirnpnsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2reiA (A:)
    tyidpetyedpnravhqfakeldascikiervigagefgevcsgrlklpgkrdvavaikt
    lkvgytekqrrdflceasimgqfdhpnvvhlegvvtrgkpvmiviefmengaldaflrkh
    dgqftviqlvgmlrgiaagmryladmgyvhrdlaarnilvnsnlvckvsdfglpvrwtap
    eaiqyrkftsasdvwsygivmwevmsygerpywdmsnqdvikaieegyrlpapmdcpagl
    hqlmldcwqkeraerpkfeqivgildkmirnpnsahh