PDB entry 2reb

View 2reb on RCSB PDB site
Description: the structure of the e. coli reca protein monomer and polymer
Deposited on 1992-03-06, released 1993-10-31
The last revision prior to the SCOP 1.69 freeze date was dated 2000-06-23, with a file datestamp of 2000-06-23.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2reb_ (-)
    aidenkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgr
    iveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpd
    tgeqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklag
    nlkqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgs
    etrvkvvknkiaapfkqaefqilygeginfygelvdlgvkekliekagawysykgekigq
    gkanatawlkdnpetakeiekkvrelllsnpnstpdfsvddsegvaetnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2reb_ (-)
    denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
    eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
    eqaleicdalarsgavdvivvdsvaaltpkaeieglaarmmsqamrklagnlkqsntlli
    finqtggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqilyg
    eginfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvre
    lll