PDB entry 2reb

View 2reb on RCSB PDB site
Description: the structure of the e. coli reca protein monomer and polymer
Class: DNA binding protein
Keywords: self-cleavage stimulation, homologous recombination, DNA binding protein
Deposited on 1992-03-06, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rec a
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2reba1, d2reba2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rebA (A:)
    aidenkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgr
    iveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpd
    tgeqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklag
    nlkqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgs
    etrvkvvknkiaapfkqaefqilygeginfygelvdlgvkekliekagawysykgekigq
    gkanatawlkdnpetakeiekkvrelllsnpnstpdfsvddsegvaetnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rebA (A:)
    denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
    eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
    eqaleicdalarsgavdvivvdsvaaltpkaeieglaarmmsqamrklagnlkqsntlli
    finqtggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqilyg
    eginfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvre
    lll