PDB entry 2rea

View 2rea on RCSB PDB site
Description: Crystal structures of C2ALPHA-PI3 kinase PX-domain domain indicate conformational change associated with ligand binding.
Class: transferase
Keywords: PX DOMAIN, PI3K, KINASE, TRANSFERASE, PHOSPHORYLATION, NUCLEAR PROTEIN, PHOSPHOINOSITIDE, Cytoplasm, Cytoplasmic vesicle, Golgi apparatus, Membrane, Nucleus, Polymorphism
Deposited on 2007-09-26, released 2007-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3C2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00443 (1-112)
      • expression tag (113-116)
    Domains in SCOPe 2.08: d2reaa1, d2reaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2reaA (A:)
    mdgrikevsvftyhkkynpdkhyiyvvrilregqiepsfvfrtfdefqelhnklsiifpl
    wklpgfpnrmvlgrthikdvaakrkielnsylqslmnastdvaecdlvctffhgshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2reaA (A:)
    dgrikevsvftyhkkynpdkhyiyvvrilregqiepsfvfrtfdefqelhnklsiifplw
    klpgfpnrmvlgrthikdvaakrkielnsylqslmnastdvaecdlvctffhgshh