PDB entry 2re9

View 2re9 on RCSB PDB site
Description: Crystal structure of TL1A at 2.1 A
Class: cytokine, hormone/growth factor
Keywords: VEGI, homotrimer, metal binding, Cytokine, Membrane, Transmembrane, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2007-09-25, released 2007-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TNF superfamily ligand TL1A
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2re9a_
  • Chain 'B':
    Compound: TNF superfamily ligand TL1A
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2re9b_
  • Chain 'C':
    Compound: TNF superfamily ligand TL1A
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2re9c_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2re9A (A:)
    glkgqefapshqqvyaplradgdkprahltvvrqtptqhfknqfpalhwehelglaftkn
    rmnytnkfllipesgdyfiysqvtfrgmtsecseirqagrpnkpdsitvvitkvtdsype
    ptqllmgtksvcevgsnwfqpiylgamfslqegdklmvnvsdislvdytkedktffgafl
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >2re9A (A:)
    lradgdkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdy
    fiysqvtfrgmtsecseirqagrpnkpdsitvvitkvtdsypeptqllmgtksvcevgsn
    wfqpiylgamfslqegdklmvnvsdislvdytkedktffgafll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2re9B (B:)
    glkgqefapshqqvyaplradgdkprahltvvrqtptqhfknqfpalhwehelglaftkn
    rmnytnkfllipesgdyfiysqvtfrgmtsecseirqagrpnkpdsitvvitkvtdsype
    ptqllmgtksvcevgsnwfqpiylgamfslqegdklmvnvsdislvdytkedktffgafl
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >2re9B (B:)
    lradgdkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdy
    fiysqvtfrgmtsecseirqagrpnkpdsitvvitkvtdsypeptqllmgtksvcevgsn
    wfqpiylgamfslqegdklmvnvsdislvdytkedktffgafll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2re9C (C:)
    glkgqefapshqqvyaplradgdkprahltvvrqtptqhfknqfpalhwehelglaftkn
    rmnytnkfllipesgdyfiysqvtfrgmtsecseirqagrpnkpdsitvvitkvtdsype
    ptqllmgtksvcevgsnwfqpiylgamfslqegdklmvnvsdislvdytkedktffgafl
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >2re9C (C:)
    lradgdkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdy
    fiysqvtfrgmtsecseirqagrpnkpdsitvvitkvtdsypeptqllmgtksvcevgsn
    wfqpiylgamfslqegdklmvnvsdislvdytkedktffgafll