PDB entry 2re7

View 2re7 on RCSB PDB site
Description: crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution
Deposited on 2007-09-25, released 2007-10-09
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Psychrobacter arcticus [TaxId:259536]
    Gene: YP_263493.1, Psyc_0186
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2re7A (A:)
    gmsnqkhidkiqavikdvkfamistsnkkgdihawpmttsevnldnkeiwfigdktsdvv
    kdiqddarigltyatqdeknyvsisgdaelptdkakldelwspvysaffangkedaniql
    ikvvphgvecwlsg
    

    Sequence, based on observed residues (ATOM records):
    >2re7A (A:)
    snqkhidkiqavikdvkfamistsnkkgdihawpmttsevnldnkeiwfigdktsdvvkd
    iqddarigltyatqdeknyvsisgdaelptdkakldelwspvysaffangkedaniqlik
    vvphgvecwlsg