PDB entry 2rdv

View 2rdv on RCSB PDB site
Description: rubredoxin from desulfovibrio vulgaris miyazaki f, monoclinic crystal form
Class: electron transfer
Keywords: rubredoxin, compnd, electron transfer protein, metalloprotein, sulfate-reducing bacterium
Deposited on 1998-10-07, released 1999-05-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2rdva_
  • Chain 'B':
    Compound: rubredoxin
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2rdvb_
  • Chain 'C':
    Compound: rubredoxin
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2rdvc_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rdvA (A:)
    mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rdvB (B:)
    mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rdvC (C:)
    mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa