PDB entry 2rdp

View 2rdp on RCSB PDB site
Description: the structure of a marr family protein from bacillus stearothermophilus
Deposited on 2007-09-24, released 2007-11-13
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative transcriptional regulator MarR
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RBSTP1228
    Database cross-references and differences (RAF-indexed):
    • PDB 2RDP
  • Heterogens: NA, PO4, BME, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2rdpA (A:)
snampsamnertvaelekllryiaanlkqrgreiltnypitppqfvalqwlleegdltvg
elsnkmylacstttdlvdrmernglvarvrdehdrrvvrirllekgeriieeviekrqrd
lanvlesfsdeeivvferclrklhqemtke

    Sequence, based on observed residues (ATOM records):
    >2rdpA (A:)
amnertvaelekllryiaanlkqrgreiltnypitppqfvalqwlleegdltvgelsnkm
ylacstttdlvdrmernglvarvrdehvvrirllekgeriieeviekrqrdlanvlesfs
deeivvferclrklhqemtk