PDB entry 2rdh

View 2rdh on RCSB PDB site
Description: Crystal structure of Staphylococcal Superantigen-Like protein 11
Class: toxin
Keywords: OB fold, beta grasp, TOXIN
Deposited on 2007-09-24, released 2007-12-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superantigen-like protein 11
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SSL11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rdha1, d2rdha2
  • Chain 'B':
    Compound: Superantigen-like protein 11
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SSL11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rdhb1, d2rdhb2
  • Chain 'C':
    Compound: Superantigen-like protein 11
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SSL11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rdhc1, d2rdhc2
  • Chain 'D':
    Compound: Superantigen-like protein 11
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SSL11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rdhd1, d2rdhd2
  • Heterogens: PO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rdhA (A:)
    stlevrsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdg
    nnenldvfvvregsgrqadnnsiggitktnrtqhidtvqnvnllvskstgqhttsvtstn
    ysiykeeislkeldfklrkhlidkhdlyktepkdskirvtmkngdfytfelnkklqthrm
    gdvidgrniekievnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdhA (A:)
    rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl
    dvfvvrednnsiggitktnrtqhidtvqnvnllvskstgqhttsvtstnysiykeeislk
    eldfklrkhlidkhdlyktepkdskirvtmkngdfytfelnkklqthrmgdvidgrniek
    ievnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rdhB (B:)
    stlevrsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdg
    nnenldvfvvregsgrqadnnsiggitktnrtqhidtvqnvnllvskstgqhttsvtstn
    ysiykeeislkeldfklrkhlidkhdlyktepkdskirvtmkngdfytfelnkklqthrm
    gdvidgrniekievnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdhB (B:)
    rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl
    dvfvvregsgrqadnnsiggitktnrtqhitvqnvnllvskstgqhttsvtstnysiyke
    eislkeldfklrkhlidkhdlyktepkdskirvtmkngdfytfelnkklqthrmgdvidg
    rniekievnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rdhC (C:)
    stlevrsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdg
    nnenldvfvvregsgrqadnnsiggitktnrtqhidtvqnvnllvskstgqhttsvtstn
    ysiykeeislkeldfklrkhlidkhdlyktepkdskirvtmkngdfytfelnkklqthrm
    gdvidgrniekievnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdhC (C:)
    vrsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnen
    ldvfvvregsgrqadnnsiggitktnrtqhidtvqnvnllvskstgqhttsvtstnysiy
    keeislkeldfklrkhlidkhdlyktepkdskirvtmkngdfytfelnkklqthrmgdvi
    dgrniekievnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rdhD (D:)
    stlevrsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdg
    nnenldvfvvregsgrqadnnsiggitktnrtqhidtvqnvnllvskstgqhttsvtstn
    ysiykeeislkeldfklrkhlidkhdlyktepkdskirvtmkngdfytfelnkklqthrm
    gdvidgrniekievnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdhD (D:)
    rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl
    dvfvvregsgrqadnnsiggitktnrtqhidtvqnvnllvskstgqhttsvtstnysiyk
    eeislkeldfklrkhlidkhdlyktepkdskirvtmkngdfytfelnkklqthrmgdvid
    grniekievnl