PDB entry 2rdg

View 2rdg on RCSB PDB site
Description: Crystal structure of Staphylococcal Superantigen-Like protein 11 in complex with Sialyl Lewis X
Class: toxin
Keywords: OB fold, beta grasp, protein-carbohydrate complex, TOXIN
Deposited on 2007-09-24, released 2007-12-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superantigen-like protein 11
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SSL11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rdga1, d2rdga2
  • Heterogens: K, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rdgA (A:)
    stlevrsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdg
    nnenldvfvvregsgrqadnnsiggitktnrtqhidtvqnvnllvskstgqhttsvtstn
    ysiykeeislkeldfklrkhlidkhdlyktepkdskirvtmkngdfytfelnkklqthrm
    gdvidgrniekievnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdgA (A:)
    vrsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnen
    ldvfvvregsgrqadnnsiggitktnrtqhidtvqnvnllvskstgqhttsvtstnysiy
    keeislkeldfklrkhlidkhdlyktepkdskirvtmkngdfytfelnkklqthrmgdvi
    dgrniekievnl