PDB entry 2rdf

View 2rdf on RCSB PDB site
Description: Crystal Structure of staphyloccocal nuclease VIAGAN/E75A variant at cryogenic temperature
Class: hydrolase
Keywords: staphylococcal nuclease, long-range interactions, histidine, hyperstable variant, Calcium, Endonuclease, Hydrolase, Membrane, Metal-binding, Secreted, Zymogen
Deposited on 2007-09-22, released 2008-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.218
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: STAPHYLOCOCCUS AUREUS
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (20)
      • engineered (32)
      • engineered (40)
      • engineered (58)
      • engineered (74)
      • engineered (116)
      • engineered (127)
    Domains in SCOPe 2.06: d2rdfa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rdfA (A:)
    atstkklhkepatlikaidgntvklmykgqpmvfrlllvdipetkhpkkgvekygpeaaa
    ftkkmvenakkievafdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
    heqhlrkaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdfA (A:)
    lhkepatlikaidgntvklmykgqpmvfrlllvdipkygpeaaaftkkmvenakkievaf
    dkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqhlrkaeaqakkek
    lniws