PDB entry 2rde

View 2rde on RCSB PDB site
Description: Crystal structure of VCA0042 complexed with c-di-GMP
Class: structural genomics, unknown function
Keywords: c-di-gmp, vibrio cholerae, vca0042, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-09-22, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein VCA0042
    Species: Vibrio cholerae [TaxId:345073]
    Gene: vca0042, VC0395_0091
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rdea1, d2rdea2
  • Chain 'B':
    Compound: Uncharacterized protein VCA0042
    Species: Vibrio cholerae [TaxId:345073]
    Gene: vca0042, VC0395_0091
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rdeb1, d2rdeb2
  • Heterogens: C2E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rdeA (A:)
    mgsshhhhhhssglvprgshmtvstinstdalamvehsseltlsittpvgtkfvcrtpfi
    gthtdkfllvempkisaddlqyffqegfwmniraisprgegalihfrsqlmhilqepvpm
    aflsipntmqvsqlrkeprfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqv
    gdlvaleifsdlrgtktfppltgkicnlqrslhharyglefneegrnnaknllaqlkfng
    tkltlnaekka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdeA (A:)
    vstinstdalamvehsseltlsittpvgtkfvcrtpfigthtdkfllvempkisaddlqy
    ffqegfwmniraisprgegalihfrsqlmhilqepvpmaflsipntmqvsqlrkeprfel
    nlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtktfpplt
    gkicnlqrslhharyglefneegrnnaknllaqlkfngtkltln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rdeB (B:)
    mgsshhhhhhssglvprgshmtvstinstdalamvehsseltlsittpvgtkfvcrtpfi
    gthtdkfllvempkisaddlqyffqegfwmniraisprgegalihfrsqlmhilqepvpm
    aflsipntmqvsqlrkeprfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqv
    gdlvaleifsdlrgtktfppltgkicnlqrslhharyglefneegrnnaknllaqlkfng
    tkltlnaekka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdeB (B:)
    tvstinstdalamvehsseltlsittpvgtkfvcrtpfigthtdkfllvempkisaddlq
    yffqegfwmniraisprgegalihfrsqlmhilqepvpmaflsipntmqvsqlrkeprfe
    lnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtktfppl
    tgkicnlqrslhharyglefneegrnnaknllaqlkfngtkltln