PDB entry 2rd4

View 2rd4 on RCSB PDB site
Description: Design of specific inhibitors of Phospholipase A2: Crystal structure of the complex of phospholipase A2 with pentapeptide Leu-Val-Phe-Phe-Ala at 2.9 A resolution
Class: hydrolase
Keywords: phospholipase A2, peptide inhibitor, complex, Calcium, Hydrolase, Lipid degradation, Metal-binding, Secreted
Deposited on 2007-09-21, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: 0.251
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 1
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rd4a_
  • Chain 'B':
    Compound: Phospholipase A2 isoform 2
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rd4b_
  • Chain 'C':
    Compound: pentapeptide inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2RD4 (0-4)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rd4A (A:)
    ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
    rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rd4B (B:)
    nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
    nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarcn
    

  • Chain 'C':
    No sequence available.