PDB entry 2rd4

View 2rd4 on RCSB PDB site
Description: Design of specific inhibitors of Phospholipase A2: Crystal structure of the complex of phospholipase A2 with pentapeptide Leu-Val-Phe-Phe-Ala at 2.9 A resolution
Class: hydrolase
Keywords: phospholipase A2, peptide inhibitor, complex, Calcium, Hydrolase, Lipid degradation, Metal-binding, Secreted
Deposited on 2007-09-21, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 isoform 1
  Species: Naja sagittifera [TaxId:195058]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60043 (0-118)
  Domains in SCOPe 2.08: d2rd4a_
• Chain 'B':
  Compound: Phospholipase A2 isoform 2
  Species: Naja sagittifera [TaxId:195058]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60044 (0-118)
  Domains in SCOPe 2.08: d2rd4b_
• Chain 'C':
  Compound: pentapeptide inhibitor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2RD4 (0-4)
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rd4A (A:)
  ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
  rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rd4B (B:)
  nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
  nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarcn
  

  
  
• Chain 'C':
  No sequence available.