PDB entry 2rd1

View 2rd1 on RCSB PDB site
Description: X-Ray structure of the protein Q7CQI7. Northeast Structural Genomics Consortium target StR87A
Class: structural genomics, unknown function
Keywords: NESG, Q7CQI7, StR87A, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Lipoprotein, UNKNOWN FUNCTION
Deposited on 2007-09-20, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative outer membrane lipoprotein
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: STM1585
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CQI7 (Start-53)
      • expression tag (54-58)
    Domains in SCOPe 2.08: d2rd1a1, d2rd1a2
  • Chain 'B':
    Compound: Putative outer membrane lipoprotein
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: STM1585
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CQI7 (Start-53)
      • expression tag (54-58)
    Domains in SCOPe 2.08: d2rd1b2, d2rd1b3
  • Chain 'C':
    Compound: Putative outer membrane lipoprotein
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: STM1585
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CQI7 (Start-53)
      • expression tag (54-58)
    Domains in SCOPe 2.08: d2rd1c2, d2rd1c3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rd1A (A:)
    cttnyvmttkngqtivtqgkpqldketgmtsytdqegnqreinsndvaqlikadlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rd1A (A:)
    tnyvmttkngqtivtqgkpqldketgmtsytdqegnqreinsndvaqlikadlehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rd1B (B:)
    cttnyvmttkngqtivtqgkpqldketgmtsytdqegnqreinsndvaqlikadlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rd1B (B:)
    ttnyvmttkngqtivtqgkpqldketgmtsytdqegnqreinsndvaqlikadlehhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rd1C (C:)
    cttnyvmttkngqtivtqgkpqldketgmtsytdqegnqreinsndvaqlikadlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rd1C (C:)
    ttnyvmttkngqtivtqgkpqldketgmtsytdqegnqreinsndvaqlikadlehhh