PDB entry 2rcz

View 2rcz on RCSB PDB site
Description: Structure of the second PDZ domain of ZO-1
Deposited on 2007-09-20, released 2007-10-09
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tight junction protein ZO-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TJP1, ZO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07157 (2-End)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Tight junction protein ZO-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TJP1, ZO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07157 (2-80)
      • expression tag (0-1)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2rczA (A:)
gskvtlvksrkneeyglrlashifvkeisqdslaardgniqegdvvlkingtvtenmslt
daktlierskgklkmvvqrde

    Sequence, based on observed residues (ATOM records):
    >2rczA (A:)
gskvtlvksrkneeyglrlashifvkeisqdslaardgniqegdvvlkingtvtenmslt
daktlierskgklkmvvqr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2rczB (B:)
gskvtlvksrkneeyglrlashifvkeisqdslaardgniqegdvvlkingtvtenmslt
daktlierskgklkmvvqrde