PDB entry 2rcu

View 2rcu on RCSB PDB site
Description: Crystal structure of rat carnitine palmitoyltransferase 2 in complex with r-3-(hexadecanoylamino)-4-(trimethylazaniumyl)butanoate
Class: transferase
Keywords: TRANSFERASE, ACYLTRANSFERASE, MITOCHONDRIAL PROTEIN, Acetylation, Fatty acid metabolism, Inner membrane, Lipid metabolism, Membrane, Mitochondrion, Transit peptide, Transport, TRANSFERASE 04-MAI-06 R
Deposited on 2007-09-20, released 2007-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carnitine O-palmitoyltransferase 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cpt2, Cpt-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rcua1
  • Chain 'B':
    Compound: Carnitine O-palmitoyltransferase 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cpt2, Cpt-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rcub1
  • Heterogens: BOG, BUJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rcuA (A:)
    mgsshhhhhhssglvprgshmavsgpddylqhsivptmhyqdslprlpipkledtmkryl
    naqkpllddsqfrrtealcknfetgvgkelhahllaqdkqnkhtsyisgpwfdmyltard
    sivlnfnpfmafnpdpkseyndqltratnltvsavrflktlqagllepevfhlnpsksdt
    dafkrlirfvppslswygaylvnaypldmsqyfrlfnstriprpnrdelftdtkarhllv
    lrkghfyvfdvldqdgnivnpleiqahlkyilsdsspvpefpvayltsenrdvwaelrqk
    lifdgneetlkkvdsavfclclddfpmkdlihlshtmlhgdgtnrwfdksfnlivaedgt
    aavhfehswgdgvavlrffnevfrdstqtpaitpqsqpaatnssasvetlsfnlsgalka
    gitaakekfdttvktlsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvat
    yescstaafkhgrtetirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltke
    aamgqgfdrhlyalrylatarglnlpelyldpayqqmnhnilststlnspavslggfapv
    vpdgfgiayavhddwigcnvssysgrnareflhcvqkcledifdalegkaikt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rcuA (A:)
    ddylqhsivptmhyqdslprlpipkledtmkrylnaqkpllddsqfrrtealcknfetgv
    gkelhahllaqdkqnkhtsyisgpwfdmyltardsivlnfnpfmafnpdpkseyndqltr
    atnltvsavrflktlqagllepevfhlnpsksdtdafkrlirfvppslswygaylvnayp
    ldmsqyfrlfnstriprpnrdelftdtkarhllvlrkghfyvfdvldqdgnivnpleiqa
    hlkyilsdsspvpefpvayltsenrdvwaelrqklifdgneetlkkvdsavfclclddfp
    mkdlihlshtmlhgdgtnrwfdksfnlivaedgtaavhfehswgdgvavlrffnevfrds
    tqtpaitpqsqpaatnssasvetlsfnlsgalkagitaakekfdttvktlsidsiqfqrg
    gkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrtetirpasiftkr
    cseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalrylatarglnlp
    elyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddwigcnvssysgr
    nareflhcvqkcledifdalegkaikt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rcuB (B:)
    mgsshhhhhhssglvprgshmavsgpddylqhsivptmhyqdslprlpipkledtmkryl
    naqkpllddsqfrrtealcknfetgvgkelhahllaqdkqnkhtsyisgpwfdmyltard
    sivlnfnpfmafnpdpkseyndqltratnltvsavrflktlqagllepevfhlnpsksdt
    dafkrlirfvppslswygaylvnaypldmsqyfrlfnstriprpnrdelftdtkarhllv
    lrkghfyvfdvldqdgnivnpleiqahlkyilsdsspvpefpvayltsenrdvwaelrqk
    lifdgneetlkkvdsavfclclddfpmkdlihlshtmlhgdgtnrwfdksfnlivaedgt
    aavhfehswgdgvavlrffnevfrdstqtpaitpqsqpaatnssasvetlsfnlsgalka
    gitaakekfdttvktlsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvat
    yescstaafkhgrtetirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltke
    aamgqgfdrhlyalrylatarglnlpelyldpayqqmnhnilststlnspavslggfapv
    vpdgfgiayavhddwigcnvssysgrnareflhcvqkcledifdalegkaikt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rcuB (B:)
    ddylqhsivptmhyqdslprlpipkledtmkrylnaqkpllddsqfrrtealcknfetgv
    gkelhahllaqdkqnkhtsyisgpwfdmyltardsivlnfnpfmafnpdpkseyndqltr
    atnltvsavrflktlqagllepevfhlnpsksdtdafkrlirfvppslswygaylvnayp
    ldmsqyfrlfnstriprpnrdelftdtkarhllvlrkghfyvfdvldqdgnivnpleiqa
    hlkyilsdsspvpefpvayltsenrdvwaelrqklifdgneetlkkvdsavfclclddfp
    mkdlihlshtmlhgdgtnrwfdksfnlivaedgtaavhfehswgdgvavlrffnevfrds
    tqtpaitpqsqpaatnssasvetlsfnlsgalkagitaakekfdttvktlsidsiqfqrg
    gkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrtetirpasiftkr
    cseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalrylatarglnlp
    elyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddwigcnvssysgr
    nareflhcvqkcledifdalegkaikt