PDB entry 2rcs

View 2rcs on RCSB PDB site
Description: immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody
Class: germline antibody
Keywords: germline antibody, fab, catalytic antibody, affinity maturation
Deposited on 1997-05-14, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin 48g7 germline fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rcsh1, d2rcsh2, d2rcsh3
  • Chain 'L':
    Compound: immunoglobulin 48g7 germline fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAD29608 (0-213)
      • conflict (14)
      • conflict (16)
      • conflict (19-20)
      • conflict (23)
      • conflict (27)
      • conflict (29-30)
      • conflict (33)
      • conflict (35)
      • conflict (40-41)
      • conflict (43)
      • conflict (45)
      • conflict (49)
      • conflict (52)
      • conflict (54-55)
      • conflict (59)
      • conflict (65)
      • conflict (68)
      • conflict (70-72)
      • conflict (78-79)
      • conflict (82)
      • conflict (84)
      • conflict (88)
      • conflict (91-93)
      • conflict (95)
      • conflict (176)
    Domains in SCOPe 2.07: d2rcsl1, d2rcsl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcsH (H:)
    qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
    dpkfqgkatitadtssntaylqlssltsedtavyycasyygiywgqgttltvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcsL (L:)
    diqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec