PDB entry 2rcq

View 2rcq on RCSB PDB site
Description: Crystal structure of human apo Cellular Retinol Binding Protein II (CRBP-II)
Class: retinol-binding protein
Keywords: cellular retinol binding protein II, CRBP-II, retinol, lipid-binding protein, Retinol-binding, Transport, Vitamin A, RETINOL-BINDING PROTEIN
Deposited on 2007-09-20, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein II, cellular
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (4-136)
      • expression tag (0-3)
      • expression tag (137-140)
    Domains in SCOPe 2.08: d2rcqa1, d2rcqa2, d2rcqa3
  • Heterogens: SO4, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcqA (A:)
    mrgstrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttst
    frnydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdkly
    leltcgdqvcrqvfkkklvpr