PDB entry 2rcj

View 2rcj on RCSB PDB site
Description: Solution structure of human Immunoglobulin M
Class: immune system
Keywords: Immunoglobulin M; polymeric antibodies; immunology; X-ray solution scattering; constrained modelling, IMMUNE SYSTEM
Deposited on 2007-09-20, released 2008-01-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: SAXS
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunogloblin M heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-217)
    Domains in SCOPe 2.06: d2rcja1, d2rcja2
  • Chain 'B':
    Compound: Immunogloblin M heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-217)
    Domains in SCOPe 2.06: d2rcjb1, d2rcjb2
  • Chain 'C':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-522)
  • Chain 'D':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-522)
  • Chain 'E':
    Compound: Immunogloblin M heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-217)
    Domains in SCOPe 2.06: d2rcje1, d2rcje2
  • Chain 'F':
    Compound: Immunogloblin M heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-217)
    Domains in SCOPe 2.06: d2rcjf1, d2rcjf2
  • Chain 'G':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-522)
  • Chain 'H':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-522)
  • Chain 'I':
    Compound: Immunogloblin M heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-217)
    Domains in SCOPe 2.06: d2rcji1, d2rcji2
  • Chain 'J':
    Compound: Immunogloblin M heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-217)
    Domains in SCOPe 2.06: d2rcjj1, d2rcjj2
  • Chain 'K':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-522)
  • Chain 'L':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-522)
  • Chain 'M':
    Compound: Immunogloblin M heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-217)
    Domains in SCOPe 2.06: d2rcjm1, d2rcjm2
  • Chain 'N':
    Compound: Immunogloblin M heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-217)
    Domains in SCOPe 2.06: d2rcjn1, d2rcjn2
  • Chain 'O':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-522)
  • Chain 'P':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-522)
  • Chain 'Q':
    Compound: Immunogloblin M heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-217)
    Domains in SCOPe 2.06: d2rcjq1, d2rcjq2
  • Chain 'R':
    Compound: Immunogloblin M heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-217)
    Domains in SCOPe 2.06: d2rcjr1, d2rcjr2
  • Chain 'S':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-522)
  • Chain 'T':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-522)
  • Chain 'U':
    Compound: J chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2RCJ (0-103)
    Domains in SCOPe 2.06: d2rcju1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjA (A:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjB (B:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjE (E:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjF (F:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjI (I:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjJ (J:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjM (M:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjN (N:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjQ (Q:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjR (R:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rcjU (U:)
    sastkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc