PDB entry 2rc4

View 2rc4 on RCSB PDB site
Description: Crystal Structure of the HAT domain of the human MOZ protein
Class: transferase
Keywords: Coenzyme A binding domain, zinc-finger, helix-turn-helix, Activator, Acyltransferase, Chromatin regulator, Metal-binding, Nucleus, Phosphorylation, Proto-oncogene, Repressor, Transcription, Transcription regulation, Transferase
Deposited on 2007-09-19, released 2007-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase MYST3
    Species: Homo sapiens [TaxId:9606]
    Gene: MYST3, MOZ, RUNXBP2, ZNF220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rc4a1
  • Heterogens: ZN, ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rc4A (A:)
    ppdpqvrcpsviefgkyeihtwysspypqeysrlpklylcefclkymksrtilqqhmkkc
    gwfhppaneiyrknnisvfevdgnvstiycqnlcllaklfldhktlyydvepflfyvltq
    ndvkgchlvgyfskekhcqqkynvscimilpqyqrkgygrflidfsyllskregqagspe
    kplsdlgrlsymaywksvileclyhqndkqisikklskltgicpqditstlhhlrmldfr
    sdqfvrrrrekliqdhmaklqlnlrpvdvdpeclrwtpvivsnskkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rc4A (A:)
    rcpsviefgkyeihtwysspypqeysrlpklylcefclkymksrtilqqhmkkcgwfhpp
    aneiyrknnisvfevdgnvstiycqnlcllaklfldhktlyydvepflfyvltqndvkgc
    hlvgyfskekhcqqkynvscimilpqyqrkgygrflidfsyllskregqagspekplsdl
    grlsymaywksvileclyhqndkqisikklskltgicpqditstlhhlrmldrrekliqd
    hmaklqlnlrpvdvdpeclrwtpv