PDB entry 2rc2

View 2rc2 on RCSB PDB site
Description: Cytochrome C Peroxidase W191G in complex with 1-methyl-2-vinyl-pyridinium
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2007-09-19, released 2008-03-18
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-22, with a file datestamp of 2008-04-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.147
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae
    Gene: CCP1, CCP, CPO
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7A026 (1-291)
      • engineered (50)
      • engineered (188)
      • engineered (269)
    Domains in SCOP 1.75: d2rc2x1
  • Heterogens: HEM, 286, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rc2X (X:)
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
kylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl