PDB entry 2rbx

View 2rbx on RCSB PDB site
Description: Cytochrome C Peroxidase W191G in complex with pyrimidine-2,4,6-triamine.
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2007-09-19, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.153
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:307796]
    Gene: CCP1, CCP, CPO
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7A026 (1-291)
      • engineered (50)
      • engineered (188)
      • engineered (269)
    Domains in SCOPe 2.06: d2rbxx_
  • Heterogens: PO4, HEM, 3AY, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rbxX (X:)
    tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
    tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
    kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
    knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
    kylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl