PDB entry 2rbr

View 2rbr on RCSB PDB site
Description: 2-phenoxyethanol in complex with T4 lysozyme L99A/M102Q
Class: hydrolase
Keywords: protein cavities, HYDROLASE
Deposited on 2007-09-19, released 2008-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-161)
      • engineered (98)
      • engineered (101)
    Domains in SCOPe 2.08: d2rbra_
  • Heterogens: PO4, 268, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rbrA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk