PDB entry 2rbm

View 2rbm on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS I72K at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, Calcium, Endonuclease, Metal-binding, Secreted, Zymogen
Deposited on 2007-09-19, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (43-44)
      • engineered (65)
      • engineered (110)
      • engineered (121)
    Domains in SCOPe 2.07: d2rbma_
  • Heterogens: CA, PO4, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rbmA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkkevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rbmA (A:)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakk
    kevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaq
    akkeklniws