PDB entry 2rbk

View 2rbk on RCSB PDB site
Description: X-ray Crystallographic Structures Show Conservation of a Trigonal-Bipyramidal Intermediate in a Phosphoryl-transfer Superfamily.
Class: unknown function
Keywords: HAD-like phosphatase, UNKNOWN FUNCTION
Deposited on 2007-09-19, released 2008-04-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.123
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: Bacteroides thetaiotaomicron
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2rbka_
  • Heterogens: MG, VN4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rbkA (A:)
    mtkalffdidgtlvsfethripsstiealeaahakglkifiatgrpkaiinnlselqdrn
    lidgyitmngaycfvgeeviyksaipqeevkamaafcekkgvpcifveehnisvcqpnem
    vkkifydflhvnviptvsfeeasnkeviqmtpfiteeeekevlpsiptceigrwypafad
    vtakgdtkqkgideiirhfgikleetmsfgdggndismlrhaaigvamgqakedvkaaad
    yvtapidedgiskamkhfgii