PDB entry 2rat

View 2rat on RCSB PDB site
Description: effects of temperature on protein structure and dynamics: x-ray crystallographic studies of the protein ribonuclease-a at nine different temperatures from 98 to 320 k
Class: hydrolase (nucleic acid,RNA)
Keywords: hydrolase (nucleic acid,RNA)
Deposited on 1991-08-13, released 1993-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.148
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rata_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ratA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv