PDB entry 2rap

View 2rap on RCSB PDB site
Description: the small g protein rap2a in complex with GTP
Class: g protein
Keywords: g protein, GTP hydrolysis, ras, rap2a
Deposited on 1998-05-06, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.206
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rap2a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rapa_
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rapA (A:)
    mreykvvvlgsggvgksaltvqfvtgtfiekydptiedfyrkeievdsspsvleildtag
    teqfasmrdlyikngqgfilvyslvnqqsfqdikpmrdqiirvkryekvpvilvgnkvdl
    eserevsssegralaeewgcpfmetsaksktmvdelfaeivrqmnya