PDB entry 2ral

View 2ral on RCSB PDB site
Description: Crystal Structure Analysis of double cysteine mutant of S.epidermidis adhesin SdrG: Evidence for the Dock,Lock and Latch ligand binding mechanism
Class: cell adhesion
Keywords: MSCRAMM, SdrG, SdrG mutant, Calcium, Cell wall, Metal-binding, Peptidoglycan-anchor, Secreted, Virulence, METAL BINDING PROTEIN, CELL ADHESION
Deposited on 2007-09-17, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.242
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine-aspartate repeat-containing protein G
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: SDRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KI13 (Start-339)
      • engineered (125)
      • engineered (339)
    Domains in SCOPe 2.07: d2rala1, d2rala2
  • Chain 'B':
    Compound: Serine-aspartate repeat-containing protein G
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: SDRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KI13 (Start-339)
      • engineered (125)
      • engineered (339)
    Domains in SCOPe 2.07: d2ralb1, d2ralb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ralA (A:)
    mgrshhhhhhgslvprgseqgsnvnhlikvtdqsitegyddsdgiikahdaenliydvtf
    evddkvksgdtmtvnidkntvpsdltdsfaipkikdnsgeiiatgtydntnkqitytftd
    yvdkycnikahlkltsyidkskvpnnntkldveyktalssvnktitveyqkpnenrtanl
    qsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddstiikvykvgdnq
    nlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikviskydpnkddytti
    qqtvtmqttineytgefrtasydntiafstssgqgqgdlc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ralA (A:)
    gsnvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgdtmtvnidknt
    vpsdltdsfaipkikdnsgeiiatgtydntnkqitytftdyvdkycnikahlkltsyidk
    skvpnnntkldveyktalssvnktitveyqkpnenrtanlqsmftnidtknhtveqtiyi
    nplrysaketnvnisgngdegstiiddstiikvykvgdnqnlpdsnriydyseyedvtnd
    dyaqlgnnndvninfgnidspyiikviskydpnkddyttiqqtvtmqttineytgefrta
    sydntiafstssgqgqgdlc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ralB (B:)
    mgrshhhhhhgslvprgseqgsnvnhlikvtdqsitegyddsdgiikahdaenliydvtf
    evddkvksgdtmtvnidkntvpsdltdsfaipkikdnsgeiiatgtydntnkqitytftd
    yvdkycnikahlkltsyidkskvpnnntkldveyktalssvnktitveyqkpnenrtanl
    qsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddstiikvykvgdnq
    nlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikviskydpnkddytti
    qqtvtmqttineytgefrtasydntiafstssgqgqgdlc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ralB (B:)
    gsnvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgdtmtvnidknt
    vpsdltdsaipkigeiiatgtydntnkqitytftdyvdkycnikahlkltsyidkskvpn
    nntkldveyktalssvnktitveyqkpnenrtanlqsmftnidtknhtveqtiyinplry
    saketnvnisgngdegstiiddstiikvykvgdnqnlpdsnriydyseyedvtnddyaql
    gnnndvninfgnidspyiikviskydpnkddyttiqqtvtmqttineytgefrtasydnt
    iafstssgqgqgdlc