PDB entry 2ra9

View 2ra9 on RCSB PDB site
Description: crystal structure of a duf1285 family protein (sbal_2486) from shewanella baltica os155 at 1.40 a resolution
Deposited on 2007-09-14, released 2007-10-16
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein DUF1285
    Species: Shewanella baltica [TaxId:325240]
    Gene: YP_001050848.1, Sbal_2486
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2ra9A (A:)
gqhtlkqfaadsalttttplcsevplfdinalgdwtylgtslpakfaklfasilhcidde
yflitpvekvrvqvedapllivdferaqphsllnvstsigtlhhnvdikqmkltddsvyl
plerglwgklgracyynfvnefnlsdlneq

    Sequence, based on observed residues (ATOM records):
    >2ra9A (A:)
sevplfdinalgdwtylgtslpakfaklfasilhciddeyflitpvekvrvqvedaplli
vdferaqphsllnvstsigtlhhnvdikqmkltddsvylplerglwgklgracyynfvne
fnlsdln