PDB entry 2ra7

View 2ra7 on RCSB PDB site
Description: Crystal Structure of Focal Adhesion Kinase FAT Domain Complexed With a Specific Small Molecule Inhibitor
Class: transferase
Keywords: Focal Adhesion Kinase, FAT Domain, Small Molecule Inhibitor, cancer, Alternative splicing, ATP-binding, Cell junction, Nucleotide-binding, Phosphorylation, Transferase, Tyrosine-protein kinase
Deposited on 2007-09-14, released 2008-09-16
The last revision prior to the SCOP 1.75 freeze date was dated 2008-09-16, with a file datestamp of 2008-09-12.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.242
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ra7a1
  • Heterogens: ACT, ZN, C4C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ra7A (A:)
ndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdetipllpasth
reiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaahalavdaknlldvidq
arlkmlgq