PDB entry 2ra7

View 2ra7 on RCSB PDB site
Description: Crystal Structure of Focal Adhesion Kinase FAT Domain Complexed With a Specific Small Molecule Inhibitor
Class: transferase
Keywords: Focal Adhesion Kinase, FAT Domain, Small Molecule Inhibitor, cancer, ATP-binding, Cell junction, Nucleotide-binding, Phosphorylation, Transferase, Tyrosine-protein kinase
Deposited on 2007-09-14, released 2008-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.242
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ra7a_
  • Heterogens: ACT, ZN, C4C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ra7A (A:)
    ndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdetipllpasth
    reiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaahalavdaknlldvidq
    arlkmlgq