PDB entry 2ra4

View 2ra4 on RCSB PDB site
Description: Crystal Structure of Human Monocyte Chemoattractant Protein 4 (MCP-4/CCL13)
Class: cytokine
Keywords: CCL13, MCP-4, CC chemokine family, chemotaxis, monocytes, Cytokine, Inflammatory response, Pyrrolidone carboxylic acid, Secreted
Deposited on 2007-09-14, released 2008-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small-inducible cytokine A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL13, MCP4, NCC1, SCYA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ra4a_
  • Chain 'B':
    Compound: Small-inducible cytokine A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL13, MCP4, NCC1, SCYA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ra4b_
  • Heterogens: SO4, TFA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ra4A (A:)
    mqpdalnvpstccftfsskkislqrlksyvittsrcpqkavifrtklgkeicadpkekwv
    qnymkhlgrkahtlkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ra4A (A:)
    dalnvpstccftfsskkislqrlksyvittsrcpqkavifrtklgkeicadpkekwvqny
    mkhlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ra4B (B:)
    mqpdalnvpstccftfsskkislqrlksyvittsrcpqkavifrtklgkeicadpkekwv
    qnymkhlgrkahtlkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ra4B (B:)
    dalnvpstccftfsskkislqrlksyvittsrcpqkavifrtklgkeicadpkekwvqny
    mkhlg