PDB entry 2r9z

View 2r9z on RCSB PDB site
Description: Glutathione amide reductase from Chromatium gracile
Deposited on 2007-09-14, released 2008-02-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione amide reductase
    Species: Marichromatium gracile [TaxId:1048]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R9Z
  • Chain 'B':
    Compound: Glutathione amide reductase
    Species: Marichromatium gracile [TaxId:1048]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R9Z
  • Heterogens: FAD, CL, NI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2r9zA (A:)
    mtqhfdliaigggsgglavaekaaafgkrvalieskalggtcvnvgcvpkkvmwyashla
    eavrdapgfgvqasggtldwprlvagrdryigainsfwdgyverlgitrvdgharfvdah
    tievegqrlsadhiviatggrpivprlpgaelgitsdgffalqqqpkrvaiigagyigie
    lagllrsfgsevtvvaledrllfqfdpllsatlaenmhaqgiethlefavaalerdaqgt
    tlvaqdgtrlegfdsviwavgrapntrdlgleaagievqsngmvptdayqntnvpgvyal
    gditgrdqltpvaiaagrrlaerlfdgqserkldydniptvvfahpplskvglsepeare
    rlgdvltvyetsftpmryalnehgpktamklvcagpeqrvvgvhvigdgademlqgfava
    vkmgatkadfdntvaihpgsaeelvtlkepvrrpgdplpegaa
    

    Sequence, based on observed residues (ATOM records):
    >2r9zA (A:)
    tqhfdliaigggsgglavaekaaafgkrvalieskalggtcvnvgcvpkkvmwyashlae
    avrdapgfgvqasldwprlvagrdryigainsfwdgyverlgitrvdgharfvdahtiev
    egqrlsadhiviatggrpivprlpgaelgitsdgffalqqqpkrvaiigagyigielagl
    lrsfgsevtvvaledrllfqfdpllsatlaenmhaqgiethlefavaalerdaqgttlva
    qdgtrlegfdsviwavgrapntrdlgleaagievqsngmvptdayqntnvpgvyalgdit
    grdqltpvaiaagrrlaerlfdgqserkldydniptvvfahpplskvglsepearerlgd
    vltvyetsftpmryalnehgpktamklvcagpeqrvvgvhvigdgademlqgfavavkmg
    atkadfdntvaihpgsaeelvtlkepvrrpg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2r9zB (B:)
    mtqhfdliaigggsgglavaekaaafgkrvalieskalggtcvnvgcvpkkvmwyashla
    eavrdapgfgvqasggtldwprlvagrdryigainsfwdgyverlgitrvdgharfvdah
    tievegqrlsadhiviatggrpivprlpgaelgitsdgffalqqqpkrvaiigagyigie
    lagllrsfgsevtvvaledrllfqfdpllsatlaenmhaqgiethlefavaalerdaqgt
    tlvaqdgtrlegfdsviwavgrapntrdlgleaagievqsngmvptdayqntnvpgvyal
    gditgrdqltpvaiaagrrlaerlfdgqserkldydniptvvfahpplskvglsepeare
    rlgdvltvyetsftpmryalnehgpktamklvcagpeqrvvgvhvigdgademlqgfava
    vkmgatkadfdntvaihpgsaeelvtlkepvrrpgdplpegaa
    

    Sequence, based on observed residues (ATOM records):
    >2r9zB (B:)
    tqhfdliaigggsgglavaekaaafgkrvalieskalggtcvnvgcvpkkvmwyashlae
    avrdapgfgvqasgtldwprlvagrdryigainsfwdgyverlgitrvdgharfvdahti
    evegqrlsadhiviatggrpivprlpgaelgitsdgffalqqqpkrvaiigagyigiela
    gllrsfgsevtvvaledrllfqfdpllsatlaenmhaqgiethlefavaalerdaqgttl
    vaqdgtrlegfdsviwavgrapntrdlgleaagievqsngmvptdayqntnvpgvyalgd
    itgrdqltpvaiaagrrlaerlfdgqserkldydniptvvfahpplskvglsepearerl
    gdvltvyetsftpmryalnehgpktamklvcagpeqrvvgvhvigdgademlqgfavavk
    mgatkadfdntvaihpgsaeelvtlkepvrrpg