PDB entry 2r9v

View 2r9v on RCSB PDB site
Description: Crystal structure of ATP synthase subunit alpha (TM1612) from Thermotoga maritima at 2.10 A resolution
Class: hydrolase
Keywords: TM1612, ATP synthase subunit alpha, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, ATP synthesis, ATP-binding, CF1, Hydrogen ion transport, Hydrolase, Inner membrane, Ion transport, Membrane, Nucleotide-binding, Transport
Deposited on 2007-09-13, released 2007-10-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase subunit alpha
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM1612, atpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r9va1, d2r9va2, d2r9va3
  • Heterogens: MG, CL, ATP, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r9vA (A:)
    mgsdkihhhhhhlrinpgeitkvleekiksfeekidledtgkviqvgdgiarayglnkvm
    vselvefvetgvkgvafnleednvgiiilgeykdikeghtvrrlkriievpvgeellgrv
    vnplgepldgkgpinaknfrpieikapgviyrkpvdtplqtgikaidsmipigrgqreli
    igdrqtgktaiaidtiinqkgqgvyciyvaigqkksaiariidklrqygameyttvvvas
    asdpaslqyiapyagcamgeyfaysgrdalvvyddlskhavayrqlsllmrrppgreayp
    gdifylhsrlleravrlndklgggsltalpivetqandisayiptnvisitdgqiylepg
    lfyagqrpainvglsvsrvggsaqikamkqvagmlridlaqyreletfaqfateldpatr
    aqiirgqrlmellkqeqyspmpveeqvvvlfagvrgylddlpveevrrfekeflrfmhek
    hqdilddiktkkeltseteeklkkaieefkttfrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9vA (A:)
    ksfeekidledtgkviqvgdgiarayglnkvmvselvefvetgvkgvafnleednvgiii
    lgeykdikeghtvrrlkriievpvgeellgrvvnplgepldgkgpinaknfrpieikapg
    viyrkpvdtplqtgikaidsmipigrgqreliigdrqtgktaiaidtiinqkgqgvyciy
    vaigqkksaiariidklrqygameyttvvvasasdpaslqyiapyagcamgeyfaysgrd
    alvvyddlskhavayrqlsllmrrppgreaypgdifylhsrlleravrlndklgggslta
    lpivetqandisayiptnvisitdgqiylepglfyagqrpainvglsvsrvggsaqikam
    kqvagmlridlaqyreletfaqfateldpatraqiirgqrlmellkqeqyspmpveeqvv
    vlfagvrgylddlpveevrrfekeflrfmhekhqdilddiktkkeltseteeklkkaiee
    fkttfrv